PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0878.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 159aa    MW: 18099.2 Da    PI: 7.9696
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0878.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.5e-191166156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          r k+ ++t+eq+++Le++F  n+++  + + +L+++lgL++rqV vWFqN+Ra+ k
  Bostr.26833s0878.1.p 11 RNKKKRLTQEQVRQLENCFTVNKKLEPDLKIQLSNQLGLPQRQVAVWFQNKRARSK 66
                          567889************************************************99 PP

2HD-ZIP_I/II101.86.1e-3312104193
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rl++eqv++LE++F+ ++kLep+ K +l+++Lgl +rqvavWFqn+RAR kt+ lE ++ +L+++++a  +++++Le++v+ L++
  Bostr.26833s0878.1.p  12 NKKKRLTQEQVRQLENCFTVNKKLEPDLKIQLSNQLGLPQRQVAVWFQNKRARSKTQSLELQHCTLQSKLEAALSDKAKLEHQVQFLQD 100
                           59*************************************************************************************** PP

           HD-ZIP_I/II  90 elke 93 
                           elk+
  Bostr.26833s0878.1.p 101 ELKR 104
                           *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-18462IPR009057Homeodomain-like
SuperFamilySSF466894.02E-18569IPR009057Homeodomain-like
PROSITE profilePS5007117.167868IPR001356Homeobox domain
SMARTSM003891.6E-171072IPR001356Homeobox domain
PfamPF000463.6E-161166IPR001356Homeobox domain
CDDcd000862.89E-151169No hitNo description
PROSITE patternPS0002704366IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
METSQSQSQS RNKKKRLTQE QVRQLENCFT VNKKLEPDLK IQLSNQLGLP QRQVAVWFQN  60
KRARSKTQSL ELQHCTLQSK LEAALSDKAK LEHQVQFLQD ELKRSRNQLA LFTNYDSPVD  120
NSNLGSCEEG HDDQVVVFDE LYACFVSNGH GSSSTSWV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076441e-175AB007644.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone: K19P17.
GenBankAK2292111e-175AK229211.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-49-M21.
GenBankBT0159271e-175BT015927.1 Arabidopsis thaliana At5g53980 mRNA, complete cds.
GenBankBT0219201e-175BT021920.1 Arabidopsis thaliana At5g53980 gene, complete cds.
GenBankCP0026881e-175CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864296.11e-104ATHB52
SwissprotQ9FN291e-102ATB52_ARATH; Homeobox-leucine zipper protein ATHB-52
TrEMBLD7MTN01e-104D7MTN0_ARALL; ATHB52
STRINGfgenesh2_kg.8__1293__AT5G53980.11e-103(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.11e-100homeobox protein 52